PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim03g034110.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 214aa    MW: 25443.9 Da    PI: 8.4207
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim03g034110.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.6e-2055110257
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         rkR  +++eq++ Le+ F  ++++ +e++++LA++lgL+  qV vWFqNrRa++k+
  Sopim03g034110.0.1  55 RKRKLLSEEQVNLLERSFGDQHKLETERKAKLASELGLDPHQVAVWFQNRRARWKN 110
                         89****************************************************95 PP

2HD-ZIP_I/II109.81.9e-3556146292
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         k++ ls+eqv+lLE+sF  ++kLe+erK++la+eLgl+p+qvavWFqnrRAR+k+k+lE++y++Lk++++    e+ rLe+ev +++++l 
  Sopim03g034110.0.1  56 KRKLLSEEQVNLLERSFGDQHKLETERKAKLASELGLDPHQVAVWFQNRRARWKNKKLEEEYSKLKTQHEDTIIEKYRLETEVLKMKDQLC 146
                         66778**********************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-1847116IPR009057Homeodomain-like
PROSITE profilePS5007117.52451111IPR001356Homeobox domain
SMARTSM003891.8E-1953115IPR001356Homeobox domain
CDDcd000867.80E-1655112No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2055118IPR009057Homeodomain-like
PfamPF000461.2E-1755110IPR001356Homeobox domain
PRINTSPR000315.4E-68291IPR000047Helix-turn-helix motif
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PRINTSPR000315.4E-691107IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MKGNKVDDQM ELISHFYPQI YSQLAQQQEE TVKPRRRRKK HKDEGRDNTS EVVMRKRKLL  60
SEEQVNLLER SFGDQHKLET ERKAKLASEL GLDPHQVAVW FQNRRARWKN KKLEEEYSKL  120
KTQHEDTIIE KYRLETEVLK MKDQLCEAKK KIERLLLERK IDISSNNSPT SSIFSMEQSH  180
FNLGEFGMEG QLMDNNMLFI ADYQSTYMTL WDD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13757RKKHKDEGRDNTSEVVMRKRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755150.0HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004234562.11e-158PREDICTED: homeobox-leucine zipper protein ATHB-21-like isoform X1
SwissprotQ9ZU702e-59ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLK4BFT31e-158K4BFT3_SOLLC; Uncharacterized protein
STRINGSolyc03g034110.2.11e-157(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12892480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.15e-53homeobox protein 40